"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B7IME1"	"{'domain_architectures': 10417, 'entries': 9, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'panther': 1, 'pfam': 1, 'prosite': 2, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 10417}"	"[""SASP are bound to spore DNA. They are double-stranded DNA-binding proteins that cause DNA to change to an a-like conformation. They protect the DNA backbone from chemical and enzymatic cleavage and are thus involved in dormant spore's high resistance to UV light""]"	"BCG9842_B3981"	"[{'identifier': 'GO:0003690', 'name': 'double-stranded DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006265', 'name': 'DNA topological change', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"B7IME1_BACC2"	"fdca442fdbb27ca2c29f639496b5d8371e83e1d3"	True	False	False	61	"Small, acid-soluble spore protein, alpha/beta family"	3	""	"MVKTNKLLVPGAEQALEQFKYEIAQEFGVSLGSNTASRSNGSVGGEVTKRLVALAQQQLRG"	"unreviewed"	"{'taxId': '405531', 'scientificName': 'Bacillus cereus (strain G9842)', 'fullName': 'Bacillus cereus (strain G9842)'}"