GET /api/protein/UniProt/B7HE82/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B7HE82",
"id": "MINC_BACC4",
"source_organism": {
"taxId": "405532",
"scientificName": "Bacillus cereus (strain B4264)",
"fullName": "Bacillus cereus (strain B4264)"
},
"name": "Probable septum site-determining protein MinC",
"description": [
"Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization"
],
"length": 228,
"sequence": "MEEKKQQNVTIKGTKDGITLHLDDCCSFSELLMELDEKLSTHYYDGDGRSLIEVHVKVGNRYLTEVQQEEIRTLIRNKKNLVVDSIESDVITKAEAIAWKEETEIVPISKIVRSGQVLHVKGNLLLIGDVNPGGTVIAGGNIFVVGSLRGIAHAGYYGDSDAVIAASVMNPMQLRISDVAMRAPEEKEDGAEAAECAYINENNHIVVDRLQLLTHLRPNLTKLERGIV",
"proteome": null,
"gene": "minC",
"go_terms": [
{
"identifier": "GO:0000902",
"name": "cell morphogenesis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0051726",
"name": "regulation of cell cycle",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:1901891",
"name": "regulation of cell septum assembly",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e470882331a7b715b71cc090ee0fbfc7d59aa919",
"counters": {
"domain_architectures": 2562,
"entries": 13,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"pfam": 2,
"ssf": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 2562
}
}
}