"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B7HE82"	"{'domain_architectures': 2562, 'entries': 13, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'pfam': 2, 'ssf': 1, 'panther': 1, 'hamap': 1, 'ncbifam': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 2562}"	"['Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings. Prevents FtsZ polymerization']"	"minC"	"[{'identifier': 'GO:0000902', 'name': 'cell morphogenesis', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0051726', 'name': 'regulation of cell cycle', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:1901891', 'name': 'regulation of cell septum assembly', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"MINC_BACC4"	"e470882331a7b715b71cc090ee0fbfc7d59aa919"	True	False	False	228	"Probable septum site-determining protein MinC"	3	""	"MEEKKQQNVTIKGTKDGITLHLDDCCSFSELLMELDEKLSTHYYDGDGRSLIEVHVKVGNRYLTEVQQEEIRTLIRNKKNLVVDSIESDVITKAEAIAWKEETEIVPISKIVRSGQVLHVKGNLLLIGDVNPGGTVIAGGNIFVVGSLRGIAHAGYYGDSDAVIAASVMNPMQLRISDVAMRAPEEKEDGAEAAECAYINENNHIVVDRLQLLTHLRPNLTKLERGIV"	"reviewed"	"{'taxId': '405532', 'scientificName': 'Bacillus cereus (strain B4264)', 'fullName': 'Bacillus cereus (strain B4264)'}"
