GET /api/protein/UniProt/B7HE81/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B7HE81",
"id": "B7HE81_BACC4",
"source_organism": {
"taxId": "405532",
"scientificName": "Bacillus cereus (strain B4264)",
"fullName": "Bacillus cereus (strain B4264)"
},
"name": "Septum site-determining protein MinD",
"description": [
"ATPase required for the correct placement of the division site. Cell division inhibitors MinC and MinD act in concert to form an inhibitor capable of blocking formation of the polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings"
],
"length": 265,
"sequence": "MGEAIVITSGKGGVGKTTTSANIGTALALSGKKVCLIDTDIGLRNLDVVMGLENRIVFDLVDVVEGRCRLPQALIKDKRFDDLYLLPAAQTSDKSAVTPEQMDELIQVLRQDYDYILIDCPAGIEQGFKNAVAGADKAIVVTTPEVSSMRDADRIIGLLEKEDIEPPKLVINRVRSHMLHEQDMLDVDEIVRTLSIELLGVVEDDDEVIRATNTGEPVALQPSGKAALAYRNIARRLLGENVPLQAFEQEKVSVFAKVKNFFGIR",
"proteome": null,
"gene": "minD",
"go_terms": [
{
"identifier": "GO:0016887",
"name": "ATP hydrolysis activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a20593a32eeedde981f82d3a908f8552fa435245",
"counters": {
"domain_architectures": 39982,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"pfam": 1,
"pirsf": 1,
"panther": 1,
"ncbifam": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 39982
}
}
}