"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B7HE81"	"{'domain_architectures': 39982, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'cdd': 1, 'ssf': 1, 'pfam': 1, 'pirsf': 1, 'panther': 1, 'ncbifam': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 39982}"	"['ATPase required for the correct placement of the division site. Cell division inhibitors MinC and MinD act in concert to form an inhibitor capable of blocking formation of the polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have formed before they mature into polar Z rings']"	"minD"	"[{'identifier': 'GO:0016887', 'name': 'ATP hydrolysis activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"B7HE81_BACC4"	"a20593a32eeedde981f82d3a908f8552fa435245"	True	False	False	265	"Septum site-determining protein MinD"	3	""	"MGEAIVITSGKGGVGKTTTSANIGTALALSGKKVCLIDTDIGLRNLDVVMGLENRIVFDLVDVVEGRCRLPQALIKDKRFDDLYLLPAAQTSDKSAVTPEQMDELIQVLRQDYDYILIDCPAGIEQGFKNAVAGADKAIVVTTPEVSSMRDADRIIGLLEKEDIEPPKLVINRVRSHMLHEQDMLDVDEIVRTLSIELLGVVEDDDEVIRATNTGEPVALQPSGKAALAYRNIARRLLGENVPLQAFEQEKVSVFAKVKNFFGIR"	"unreviewed"	"{'taxId': '405532', 'scientificName': 'Bacillus cereus (strain B4264)', 'fullName': 'Bacillus cereus (strain B4264)'}"