HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B6I635",
"id": "GRPE_ECOSE",
"source_organism": {
"taxId": "409438",
"scientificName": "Escherichia coli (strain SE11)",
"fullName": "Escherichia coli (strain SE11)"
},
"name": "Protein GrpE",
"description": [
"Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins, in association with DnaK and GrpE. It is the nucleotide exchange factor for DnaK and may function as a thermosensor. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding"
],
"length": 197,
"sequence": "MSSKEQKTPEGQAPEEIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTVAKAKA",
"proteome": null,
"gene": "grpE",
"go_terms": [
{
"identifier": "GO:0000774",
"name": "adenyl-nucleotide exchange factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0042803",
"name": "protein homodimerization activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051087",
"name": "protein-folding chaperone binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006457",
"name": "protein folding",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "bcfacd3ac840c2030716357b736a826603778042",
"counters": {
"domain_architectures": 36652,
"entries": 16,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"cdd": 1,
"ncbifam": 3,
"hamap": 1,
"panther": 1,
"pfam": 1,
"prosite": 1,
"prints": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 36652
}
}
}