"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B6I635"	"{'domain_architectures': 36652, 'entries': 16, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 2, 'cdd': 1, 'ncbifam': 3, 'hamap': 1, 'panther': 1, 'pfam': 1, 'prosite': 1, 'prints': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 36652}"	"['Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins, in association with DnaK and GrpE. It is the nucleotide exchange factor for DnaK and may function as a thermosensor. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding']"	"grpE"	"[{'identifier': 'GO:0000774', 'name': 'adenyl-nucleotide exchange factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0042803', 'name': 'protein homodimerization activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051087', 'name': 'protein-folding chaperone binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006457', 'name': 'protein folding', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"GRPE_ECOSE"	"bcfacd3ac840c2030716357b736a826603778042"	True	False	False	197	"Protein GrpE"	3	""	"MSSKEQKTPEGQAPEEIIMDQHEEIEAVEPEASAEQVDPRDEKIANLEAQLAEAQTRERDGILRVKAEMENLRRRTELDIEKAHKFALEKFINELLPVIDSLDRALEVADKANPDMSAMVEGIELTLKSMLDVVRKFGVEVIAETNVPLDPNVHQAIAMVESDDVAPGNVLGIMQKGYTLNGRTIRAAMVTVAKAKA"	"reviewed"	"{'taxId': '409438', 'scientificName': 'Escherichia coli (strain SE11)', 'fullName': 'Escherichia coli (strain SE11)'}"
