GET /api/protein/UniProt/B5RGH6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B5RGH6",
        "id": "B5RGH6_SALG2",
        "source_organism": {
            "taxId": "550538",
            "scientificName": "Salmonella gallinarum (strain 287/91 / NCTC 13346)",
            "fullName": "Salmonella gallinarum (strain 287/91 / NCTC 13346)"
        },
        "name": "Glutaredoxin",
        "description": [
            "Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins"
        ],
        "length": 83,
        "sequence": "MANIEIYTKATCPFCHRAKALLNSKGVSFQEIAIDGDAVKREEMIKRSGRTTVPQIFIDAQHIGGCDDLYALDARGGLDPLLR",
        "proteome": null,
        "gene": "grxC",
        "go_terms": [
            {
                "identifier": "GO:0045454",
                "name": "cell redox homeostasis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d2844775b51693340b21c3e9e12379eeddc0df70",
        "counters": {
            "domain_architectures": 69322,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "profile": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "ncbifam": 2,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 69322
        }
    }
}