"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B5RGH6"	"{'domain_architectures': 69322, 'entries': 15, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'profile': 1, 'cathgene3d': 1, 'cdd': 1, 'pfam': 1, 'ncbifam': 2, 'panther': 1, 'prosite': 1, 'prints': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 69322}"	"['Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins']"	"grxC"	"[{'identifier': 'GO:0045454', 'name': 'cell redox homeostasis', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"B5RGH6_SALG2"	"d2844775b51693340b21c3e9e12379eeddc0df70"	True	False	False	83	"Glutaredoxin"	3	""	"MANIEIYTKATCPFCHRAKALLNSKGVSFQEIAIDGDAVKREEMIKRSGRTTVPQIFIDAQHIGGCDDLYALDARGGLDPLLR"	"unreviewed"	"{'taxId': '550538', 'scientificName': 'Salmonella gallinarum (strain 287/91 / NCTC 13346)', 'fullName': 'Salmonella gallinarum (strain 287/91 / NCTC 13346)'}"