GET /api/protein/UniProt/B5F981/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B5F981",
"id": "MTFA_SALA4",
"source_organism": {
"taxId": "454166",
"scientificName": "Salmonella agona (strain SL483)",
"fullName": "Salmonella agona (strain SL483)"
},
"name": "Mlc titration factor A",
"description": [
"Involved in the modulation of the activity of the glucose-phosphotransferase system (glucose-PTS). Interacts with the transcriptional repressor Mlc, preventing its interaction with DNA and leading to the modulation of expression of genes regulated by Mlc, including ptsG, which encodes the PTS system glucose-specific EIICB component",
"Shows zinc-dependent metallopeptidase activity"
],
"length": 265,
"sequence": "MIKWPWKAQEITQNEDWPWDDALAIPLLVNLTAQEQARLIALAERFLQQKRLVALQGFELDSLKSARIALIFCLPILELGIEWLDGFHEVLIYPAPFVVDDEWEDDIGLVHSQRVVQSGQSWQQGPIILNWLDILDSFDASGFNLIIHEVAHKLDMRNGDRASGIPFIPLRDVAGWEHDLHAAMNNIQDEIDLVGESAASIDAYAATDPAECFAVLSEYFFSAPELFAPRFPALWQRFCQFYRQDPSQRLRVSAAEGDYGEESEH",
"proteome": null,
"gene": "mtfA",
"go_terms": [
{
"identifier": "GO:0008237",
"name": "metallopeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "3244dd975e6e86f37b6cb4911f4766635665b1ec",
"counters": {
"domain_architectures": 6399,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"cdd": 1,
"panther": 1,
"ncbifam": 1,
"hamap": 1,
"pfam": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 6399
}
}
}