"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B5F981"	"{'domain_architectures': 6399, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 1, 'cdd': 1, 'panther': 1, 'ncbifam': 1, 'hamap': 1, 'pfam': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 6399}"	"['Involved in the modulation of the activity of the glucose-phosphotransferase system (glucose-PTS). Interacts with the transcriptional repressor Mlc, preventing its interaction with DNA and leading to the modulation of expression of genes regulated by Mlc, including ptsG, which encodes the PTS system glucose-specific EIICB component', 'Shows zinc-dependent metallopeptidase activity']"	"mtfA"	"[{'identifier': 'GO:0008237', 'name': 'metallopeptidase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"MTFA_SALA4"	"3244dd975e6e86f37b6cb4911f4766635665b1ec"	True	False	False	265	"Mlc titration factor A"	3	""	"MIKWPWKAQEITQNEDWPWDDALAIPLLVNLTAQEQARLIALAERFLQQKRLVALQGFELDSLKSARIALIFCLPILELGIEWLDGFHEVLIYPAPFVVDDEWEDDIGLVHSQRVVQSGQSWQQGPIILNWLDILDSFDASGFNLIIHEVAHKLDMRNGDRASGIPFIPLRDVAGWEHDLHAAMNNIQDEIDLVGESAASIDAYAATDPAECFAVLSEYFFSAPELFAPRFPALWQRFCQFYRQDPSQRLRVSAAEGDYGEESEH"	"reviewed"	"{'taxId': '454166', 'scientificName': 'Salmonella agona (strain SL483)', 'fullName': 'Salmonella agona (strain SL483)'}"
