General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B4ZAD6",
        "id": "B4ZAD6_BUTJA",
        "source_organism": {
            "taxId": "56263",
            "scientificName": "Buteo jamaicensis",
            "fullName": "Buteo jamaicensis (Red-tailed hawk)"
        },
        "name": "Elongation factor 2",
        "description": [
            "Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome"
        ],
        "length": 188,
        "sequence": "KFAAKGDAQLNPSERAKKVEDMMKKLWGDRYFDPATGKFSKSATSPDGKKLPRTFCQLILDPIFKVFDAIMNFKKEEAAKLIEKLDIKLDSEDKDKEGKPLLKAVMRRWLPAGDALLQMITIHLPSPVTAQKYRCELLYEGPPDDEAAIGIKNCDPKGPLMMYISKMVPTSDKGRFYAFGRVFSGLVS",
        "proteome": null,
        "gene": "EEF2",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1
        }
    }
}