"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B4ZAD6"	"{'domain_architectures': 0, 'entries': 7, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 2, 'panther': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1}"	"['Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome']"	"EEF2"	""	"B4ZAD6_BUTJA"	""	True	False	True	188	"Elongation factor 2"	4	""	"KFAAKGDAQLNPSERAKKVEDMMKKLWGDRYFDPATGKFSKSATSPDGKKLPRTFCQLILDPIFKVFDAIMNFKKEEAAKLIEKLDIKLDSEDKDKEGKPLLKAVMRRWLPAGDALLQMITIHLPSPVTAQKYRCELLYEGPPDDEAAIGIKNCDPKGPLMMYISKMVPTSDKGRFYAFGRVFSGLVS"	"unreviewed"	"{'taxId': '56263', 'scientificName': 'Buteo jamaicensis', 'fullName': 'Buteo jamaicensis (Red-tailed hawk)'}"