GET /api/protein/UniProt/B4Z9Y6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B4Z9Y6",
"id": "B4Z9Y6_ARAGA",
"source_organism": {
"taxId": "54356",
"scientificName": "Aramus guarauna",
"fullName": "Aramus guarauna (Limpkin)"
},
"name": "Pterin-4-alpha-carbinolamine dehydratase",
"description": [
"Involved in tetrahydrobiopterin biosynthesis. Seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. Coactivator for HNF1A-dependent transcription. Regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity. Also acts as a coactivator for HNF1B-dependent transcription"
],
"length": 43,
"sequence": "GRDAIFKEFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNK",
"proteome": null,
"gene": "PCBD1",
"go_terms": [
{
"identifier": "GO:0008124",
"name": "4-alpha-hydroxytetrahydrobiopterin dehydratase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006729",
"name": "tetrahydrobiopterin biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e369d4a6ba0e4ec491088fa090c6667d92b80728",
"counters": {
"domain_architectures": 21046,
"entries": 6,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 21046
}
}
}