"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B4Z9Y6"	"{'domain_architectures': 21046, 'entries': 6, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'panther': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 21046}"	"['Involved in tetrahydrobiopterin biosynthesis. Seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. Coactivator for HNF1A-dependent transcription. Regulates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity. Also acts as a coactivator for HNF1B-dependent transcription']"	"PCBD1"	"[{'identifier': 'GO:0008124', 'name': '4-alpha-hydroxytetrahydrobiopterin dehydratase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006729', 'name': 'tetrahydrobiopterin biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"B4Z9Y6_ARAGA"	"e369d4a6ba0e4ec491088fa090c6667d92b80728"	True	False	True	43	"Pterin-4-alpha-carbinolamine dehydratase"	3	""	"GRDAIFKEFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNK"	"unreviewed"	"{'taxId': '54356', 'scientificName': 'Aramus guarauna', 'fullName': 'Aramus guarauna (Limpkin)'}"