GET /api/protein/UniProt/B4TDB4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B4TDB4",
"id": "ISCA_SALHS",
"source_organism": {
"taxId": "454169",
"scientificName": "Salmonella heidelberg (strain SL476)",
"fullName": "Salmonella heidelberg (strain SL476)"
},
"name": "Iron-binding protein IscA",
"description": [
"Is able to transfer iron-sulfur clusters to apo-ferredoxin. Multiple cycles of [2Fe2S] cluster formation and transfer are observed, suggesting that IscA acts catalytically. Recruits intracellular free iron so as to provide iron for the assembly of transient iron-sulfur cluster in IscU in the presence of IscS, L-cysteine and the thioredoxin reductase system TrxA/TrxB"
],
"length": 107,
"sequence": "MSITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTAEDTVFEDKGVKVVVDGKSLQFLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGESFHV",
"proteome": null,
"gene": "iscA",
"go_terms": [
{
"identifier": "GO:0051536",
"name": "iron-sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016226",
"name": "iron-sulfur cluster assembly",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "3b7251129c2afcd06b88fd17a23387673e40b819",
"counters": {
"domain_architectures": 45207,
"entries": 15,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"pfam": 1,
"cathgene3d": 1,
"ncbifam": 3,
"hamap": 1,
"panther": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 45207
}
}
}