"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B4TDB4"	"{'domain_architectures': 45207, 'entries': 15, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'pfam': 1, 'cathgene3d': 1, 'ncbifam': 3, 'hamap': 1, 'panther': 1, 'prosite': 1, 'interpro': 6}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 45207}"	"['Is able to transfer iron-sulfur clusters to apo-ferredoxin. Multiple cycles of [2Fe2S] cluster formation and transfer are observed, suggesting that IscA acts catalytically. Recruits intracellular free iron so as to provide iron for the assembly of transient iron-sulfur cluster in IscU in the presence of IscS, L-cysteine and the thioredoxin reductase system TrxA/TrxB']"	"iscA"	"[{'identifier': 'GO:0051536', 'name': 'iron-sulfur cluster binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016226', 'name': 'iron-sulfur cluster assembly', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"ISCA_SALHS"	"3b7251129c2afcd06b88fd17a23387673e40b819"	True	False	False	107	"Iron-binding protein IscA"	3	""	"MSITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTAEDTVFEDKGVKVVVDGKSLQFLDGTQLDFVKEGLNEGFKFSNPNVKDECGCGESFHV"	"reviewed"	"{'taxId': '454169', 'scientificName': 'Salmonella heidelberg (strain SL476)', 'fullName': 'Salmonella heidelberg (strain SL476)'}"