General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B4ST29",
        "id": "B4ST29_STRM5",
        "source_organism": {
            "taxId": "391008",
            "scientificName": "Stenotrophomonas maltophilia (strain R551-3)",
            "fullName": "Stenotrophomonas maltophilia (strain R551-3)"
        },
        "name": "Tol-Pal system protein TolR",
        "description": [
            "Part of the Tol-Pal system, which plays a role in outer membrane invagination during cell division and is important for maintaining outer membrane integrity"
        ],
        "length": 142,
        "sequence": "MSAAIGRRKRRKLKSEINVVPYIDVMLVLLIIFMVTAPLLTLSFDVDLPNSNAKALESKQDPVIVSVRQDGQLSLKLPDAKEPTAVSAEELEGRLAGIAAQDKGVRVIVAADRAVAYEKVIAAMDVIKRAKVDKVGLATDAR",
        "proteome": null,
        "gene": "tolR",
        "go_terms": [
            {
                "identifier": "GO:0022857",
                "name": "transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0055085",
                "name": "transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0015031",
                "name": "protein transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d0dc1de7b722f382c0a99228cc8872557ae5c59a",
        "counters": {
            "domain_architectures": 48732,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "hamap": 1,
                "pfam": 1,
                "ncbifam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 48732
        }
    }
}