"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B4ST29"	"{'domain_architectures': 48732, 'entries': 7, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'panther': 1, 'hamap': 1, 'pfam': 1, 'ncbifam': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 48732}"	"['Part of the Tol-Pal system, which plays a role in outer membrane invagination during cell division and is important for maintaining outer membrane integrity']"	"tolR"	"[{'identifier': 'GO:0022857', 'name': 'transmembrane transporter activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0055085', 'name': 'transmembrane transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0015031', 'name': 'protein transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"B4ST29_STRM5"	"d0dc1de7b722f382c0a99228cc8872557ae5c59a"	True	False	False	142	"Tol-Pal system protein TolR"	3	""	"MSAAIGRRKRRKLKSEINVVPYIDVMLVLLIIFMVTAPLLTLSFDVDLPNSNAKALESKQDPVIVSVRQDGQLSLKLPDAKEPTAVSAEELEGRLAGIAAQDKGVRVIVAADRAVAYEKVIAAMDVIKRAKVDKVGLATDAR"	"unreviewed"	"{'taxId': '391008', 'scientificName': 'Stenotrophomonas maltophilia (strain R551-3)', 'fullName': 'Stenotrophomonas maltophilia (strain R551-3)'}"