General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B4SNX3",
        "id": "MDCC_STRM5",
        "source_organism": {
            "taxId": "391008",
            "scientificName": "Stenotrophomonas maltophilia (strain R551-3)",
            "fullName": "Stenotrophomonas maltophilia (strain R551-3)"
        },
        "name": "Malonate decarboxylase acyl carrier protein",
        "description": [
            "Subunit of malonate decarboxylase, it is an acyl carrier protein to which acetyl and malonyl thioester residues are bound via a 2'-(5''-phosphoribosyl)-3'-dephospho-CoA prosthetic group and turn over during the catalytic mechanism"
        ],
        "length": 106,
        "sequence": "METLDYRFDGTTHAHFPTNAVLVGVLASGNLEILLEPAALDGAMTVRIITAAQGFGSVWQAVITDFARRHPLRDVRISINDAGATPAVVSLRLDQAVETLLGGGTP",
        "proteome": null,
        "gene": "mdcC",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "dce758a74c6ea66deb83930fb8ef1c7852cbd340",
        "counters": {
            "domain_architectures": 5196,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "hamap": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 5196
        }
    }
}