"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B4SNX3"	"{'domain_architectures': 5196, 'entries': 5, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'hamap': 1, 'ncbifam': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 5196}"	"[""Subunit of malonate decarboxylase, it is an acyl carrier protein to which acetyl and malonyl thioester residues are bound via a 2'-(5''-phosphoribosyl)-3'-dephospho-CoA prosthetic group and turn over during the catalytic mechanism""]"	"mdcC"	""	"MDCC_STRM5"	"dce758a74c6ea66deb83930fb8ef1c7852cbd340"	True	False	False	106	"Malonate decarboxylase acyl carrier protein"	3	""	"METLDYRFDGTTHAHFPTNAVLVGVLASGNLEILLEPAALDGAMTVRIITAAQGFGSVWQAVITDFARRHPLRDVRISINDAGATPAVVSLRLDQAVETLLGGGTP"	"reviewed"	"{'taxId': '391008', 'scientificName': 'Stenotrophomonas maltophilia (strain R551-3)', 'fullName': 'Stenotrophomonas maltophilia (strain R551-3)'}"