General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B4Q2J2",
        "id": "UBE2S_DROYA",
        "source_organism": {
            "taxId": "7245",
            "scientificName": "Drosophila yakuba",
            "fullName": "Drosophila yakuba (Fruit fly)"
        },
        "name": "Ubiquitin-conjugating enzyme E2 S",
        "description": [
            "Catalyzes the covalent attachment of ubiquitin to other proteins. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by specifically elongating polyubiquitin chains initiated by the E2 enzyme vih/UbcH10 on APC/C substrates, enhancing the degradation of APC/C substrates by the proteasome and promoting mitotic exit"
        ],
        "length": 209,
        "sequence": "MSSQYSNVENLSPQTIRQVMRELQEMETTPPEGIKVLINESDVTDIQALIDGPAGTPYAAGVFRVKLTLNKDFPQTPPKAYFLTKIFHPNVAANGEICVNTLKKDWKPDLGIKHILLTIKCLLIVPNPESALNEEAGKMLLERYDDYSQRARMMTEIHAQPAKCGVGASGDAKDDDGPSTKKHAGLDKKLQDKKKEKLLKEKKRMLKRL",
        "proteome": "UP000002282",
        "gene": "GE15576",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "96b2a7d582dea26386e8f982d2fd40014d2b06f9",
        "counters": {
            "domain_architectures": 122920,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "profile": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 122920
        }
    }
}