"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B4Q2J2"	"{'domain_architectures': 122920, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'cdd': 1, 'profile': 1, 'smart': 1, 'pfam': 1, 'panther': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 122920}"	"['Catalyzes the covalent attachment of ubiquitin to other proteins. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by specifically elongating polyubiquitin chains initiated by the E2 enzyme vih/UbcH10 on APC/C substrates, enhancing the degradation of APC/C substrates by the proteasome and promoting mitotic exit']"	"GE15576"	""	"UBE2S_DROYA"	"96b2a7d582dea26386e8f982d2fd40014d2b06f9"	True	False	False	209	"Ubiquitin-conjugating enzyme E2 S"	3	"UP000002282"	"MSSQYSNVENLSPQTIRQVMRELQEMETTPPEGIKVLINESDVTDIQALIDGPAGTPYAAGVFRVKLTLNKDFPQTPPKAYFLTKIFHPNVAANGEICVNTLKKDWKPDLGIKHILLTIKCLLIVPNPESALNEEAGKMLLERYDDYSQRARMMTEIHAQPAKCGVGASGDAKDDDGPSTKKHAGLDKKLQDKKKEKLLKEKKRMLKRL"	"reviewed"	"{'taxId': '7245', 'scientificName': 'Drosophila yakuba', 'fullName': 'Drosophila yakuba (Fruit fly)'}"