GET /api/protein/UniProt/B4MZM2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B4MZM2",
        "id": "B4MZM2_DROWI",
        "source_organism": {
            "taxId": "7260",
            "scientificName": "Drosophila willistoni",
            "fullName": "Drosophila willistoni (Fruit fly)"
        },
        "name": "Thioredoxin-like protein",
        "description": [
            "Plays a role in pre-mRNA splicing as component of the U5 snRNP and U4/U6-U5 tri-snRNP complexes that are involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex)",
            "Plays role in pre-mRNA splicing"
        ],
        "length": 142,
        "sequence": "MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPACMKMDEVMYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWPLEDKQEMIDIVETVYRGARKGRGLVVSPKDYSTKYRY",
        "proteome": "UP000007798",
        "gene": "Dwil\\GK24348",
        "go_terms": [
            {
                "identifier": "GO:0000398",
                "name": "mRNA splicing, via spliceosome",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0046540",
                "name": "U4/U6 x U5 tri-snRNP complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "59aa23f52382d23a621be8cad4dabfc2ec0a1ac6",
        "counters": {
            "domain_architectures": 6453,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "cdd": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6453
        }
    }
}