"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B4MZM2"	"{'domain_architectures': 6453, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'smart': 1, 'pfam': 1, 'cdd': 1, 'pirsf': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 6453}"	"['Plays a role in pre-mRNA splicing as component of the U5 snRNP and U4/U6-U5 tri-snRNP complexes that are involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex)', 'Plays role in pre-mRNA splicing']"	"Dwil\GK24348"	"[{'identifier': 'GO:0000398', 'name': 'mRNA splicing, via spliceosome', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0046540', 'name': 'U4/U6 x U5 tri-snRNP complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"B4MZM2_DROWI"	"59aa23f52382d23a621be8cad4dabfc2ec0a1ac6"	True	False	False	142	"Thioredoxin-like protein"	3	"UP000007798"	"MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPACMKMDEVMYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWPLEDKQEMIDIVETVYRGARKGRGLVVSPKDYSTKYRY"	"unreviewed"	"{'taxId': '7260', 'scientificName': 'Drosophila willistoni', 'fullName': 'Drosophila willistoni (Fruit fly)'}"