GET /api/protein/UniProt/B3LQ09/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B3LQ09",
"id": "B3LQ09_YEAS1",
"source_organism": {
"taxId": "285006",
"scientificName": "Saccharomyces cerevisiae (strain RM11-1a)",
"fullName": "Saccharomyces cerevisiae (strain RM11-1a) (Baker's yeast)"
},
"name": "Mitochondrial import inner membrane translocase subunit TIM16",
"description": [
"Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. In the complex, it is required to regulate activity of mtHSP70 (SSC1) via its interaction with PAM18/TIM14. May act by positioning PAM18/TIM14 in juxtaposition to mtHSP70 at the translocon to maximize ATPase stimulation"
],
"length": 149,
"sequence": "MAHRAFIQVIITGTQVFGKAFAEAYRQAASQSVKQGATNASRRGTGKGEYGGITLDESCKILNIEESKGDLNMDKINNRFNYLFEVNDKEKGGSFYLQSKVYRAAERLKWELAQREKNAKAKAGDASTAKPPPNSTNSSGADNSASSNQ",
"proteome": "UP000008335",
"gene": "SCRG_03567",
"go_terms": [
{
"identifier": "GO:0030150",
"name": "protein import into mitochondrial matrix",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005744",
"name": "TIM23 mitochondrial import inner membrane translocase complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f3725d9a757d4b54e739feeae5bd9f2ec28b4f6b",
"counters": {
"domain_architectures": 4714,
"entries": 5,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4714
}
}
}