"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B3LQ09"	"{'domain_architectures': 4714, 'entries': 5, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4714}"	"['Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. In the complex, it is required to regulate activity of mtHSP70 (SSC1) via its interaction with PAM18/TIM14. May act by positioning PAM18/TIM14 in juxtaposition to mtHSP70 at the translocon to maximize ATPase stimulation']"	"SCRG_03567"	"[{'identifier': 'GO:0030150', 'name': 'protein import into mitochondrial matrix', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005744', 'name': 'TIM23 mitochondrial import inner membrane translocase complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"B3LQ09_YEAS1"	"f3725d9a757d4b54e739feeae5bd9f2ec28b4f6b"	True	False	False	149	"Mitochondrial import inner membrane translocase subunit TIM16"	3	"UP000008335"	"MAHRAFIQVIITGTQVFGKAFAEAYRQAASQSVKQGATNASRRGTGKGEYGGITLDESCKILNIEESKGDLNMDKINNRFNYLFEVNDKEKGGSFYLQSKVYRAAERLKWELAQREKNAKAKAGDASTAKPPPNSTNSSGADNSASSNQ"	"unreviewed"	"{'taxId': '285006', 'scientificName': 'Saccharomyces cerevisiae (strain RM11-1a)', 'fullName': ""Saccharomyces cerevisiae (strain RM11-1a) (Baker's yeast)""}"