GET /api/protein/UniProt/B2SM83/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B2SM83",
        "id": "MTND_XANOP",
        "source_organism": {
            "taxId": "360094",
            "scientificName": "Xanthomonas oryzae pv. oryzae (strain PXO99A)",
            "fullName": "Xanthomonas oryzae pv. oryzae (strain PXO99A)"
        },
        "name": "Acireductone dioxygenase",
        "description": [
            "Catalyzes 2 different reactions between oxygen and the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene) depending upon the metal bound in the active site. Fe-containing acireductone dioxygenase (Fe-ARD) produces formate and 2-keto-4-methylthiobutyrate (KMTB), the alpha-ketoacid precursor of methionine in the methionine recycle pathway. Ni-containing acireductone dioxygenase (Ni-ARD) produces methylthiopropionate, carbon monoxide and formate, and does not lie on the methionine recycle pathway"
        ],
        "length": 188,
        "sequence": "MSRLRIFADTNPATPEFDSRDGDAIASELKKIGVTFERWHASAPVEPGATPEQVMDAYRADIDRISAERGFKTVDVVSIAPDNPKREEMRAKFLDEHFHKEDEVRFFVAGSGLFTLHVDAKVYEIECVKDDLIAVPDSTLHWFDMGPEPHFVAIRFFTEPDGWVGHFTGTEIAKQFPRYAPEKPHKAS",
        "proteome": null,
        "gene": "mtnD1",
        "go_terms": [
            {
                "identifier": "GO:0010308",
                "name": "acireductone dioxygenase (Ni2+-requiring) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0010309",
                "name": "acireductone dioxygenase [iron(II)-requiring] activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005506",
                "name": "iron ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016151",
                "name": "nickel cation binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019284",
                "name": "L-methionine salvage from S-adenosylmethionine",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "552e74f4cc2d23d46b226a6ad8c8614d3ba679cf",
        "counters": {
            "domain_architectures": 9941,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "cdd": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 9941
        }
    }
}