"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B2SM83"	"{'domain_architectures': 9941, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'cdd': 1, 'hamap': 1, 'panther': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 9941}"	"['Catalyzes 2 different reactions between oxygen and the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene) depending upon the metal bound in the active site. Fe-containing acireductone dioxygenase (Fe-ARD) produces formate and 2-keto-4-methylthiobutyrate (KMTB), the alpha-ketoacid precursor of methionine in the methionine recycle pathway. Ni-containing acireductone dioxygenase (Ni-ARD) produces methylthiopropionate, carbon monoxide and formate, and does not lie on the methionine recycle pathway']"	"mtnD1"	"[{'identifier': 'GO:0010308', 'name': 'acireductone dioxygenase (Ni2+-requiring) activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0010309', 'name': 'acireductone dioxygenase [iron(II)-requiring] activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005506', 'name': 'iron ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016151', 'name': 'nickel cation binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0019284', 'name': 'L-methionine salvage from S-adenosylmethionine', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"MTND_XANOP"	"552e74f4cc2d23d46b226a6ad8c8614d3ba679cf"	True	False	False	188	"Acireductone dioxygenase"	3	""	"MSRLRIFADTNPATPEFDSRDGDAIASELKKIGVTFERWHASAPVEPGATPEQVMDAYRADIDRISAERGFKTVDVVSIAPDNPKREEMRAKFLDEHFHKEDEVRFFVAGSGLFTLHVDAKVYEIECVKDDLIAVPDSTLHWFDMGPEPHFVAIRFFTEPDGWVGHFTGTEIAKQFPRYAPEKPHKAS"	"reviewed"	"{'taxId': '360094', 'scientificName': 'Xanthomonas oryzae pv. oryzae (strain PXO99A)', 'fullName': 'Xanthomonas oryzae pv. oryzae (strain PXO99A)'}"
