General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B2A1E8",
        "id": "ENGB_NATTJ",
        "source_organism": {
            "taxId": "457570",
            "scientificName": "Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)",
            "fullName": "Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)"
        },
        "name": "Probable GTP-binding protein EngB",
        "description": [
            "Necessary for normal cell division and for the maintenance of normal septation"
        ],
        "length": 193,
        "sequence": "MKVTNAEYMASAYLSSQFPSEMYPEISFIGRSNVGKSSLINTLINRKNLAYTSKQPGKTRTINFFLINKSLYFVDLPGYGFAKVSKTMQKDWEQLVNAYLSQRNTLKLSILIIDGRHGPKDADIDMFDYLLDFERPVLLVATKMDKVKANKRKQRITEMRSALELDQDDELITFSSATGEGKNELWQIIEDLL",
        "proteome": "UP000001683",
        "gene": "engB",
        "go_terms": [
            {
                "identifier": "GO:0005525",
                "name": "GTP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4b93c256160c3eea4f0633720a92f3a06a024d5d",
        "counters": {
            "domain_architectures": 70445,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "ssf": 1,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 70445
        }
    }
}