"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B2A1E8"	"{'domain_architectures': 70445, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'profile': 1, 'ssf': 1, 'cdd': 1, 'panther': 1, 'ncbifam': 1, 'hamap': 1, 'pfam': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 70445}"	"['Necessary for normal cell division and for the maintenance of normal septation']"	"engB"	"[{'identifier': 'GO:0005525', 'name': 'GTP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"ENGB_NATTJ"	"4b93c256160c3eea4f0633720a92f3a06a024d5d"	True	False	False	193	"Probable GTP-binding protein EngB"	3	"UP000001683"	"MKVTNAEYMASAYLSSQFPSEMYPEISFIGRSNVGKSSLINTLINRKNLAYTSKQPGKTRTINFFLINKSLYFVDLPGYGFAKVSKTMQKDWEQLVNAYLSQRNTLKLSILIIDGRHGPKDADIDMFDYLLDFERPVLLVATKMDKVKANKRKQRITEMRSALELDQDDELITFSSATGEGKNELWQIIEDLL"	"reviewed"	"{'taxId': '457570', 'scientificName': 'Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)', 'fullName': 'Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)'}"
