GET /api/protein/UniProt/B1YCG8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B1YCG8",
        "id": "IF2B_PYRNV",
        "source_organism": {
            "taxId": "444157",
            "scientificName": "Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / NBRC 100436 / V24Sta)",
            "fullName": "Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / NBRC 100436 / V24Sta)"
        },
        "name": "Translation initiation factor 2 subunit beta",
        "description": [
            "eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA"
        ],
        "length": 134,
        "sequence": "MDEEYIALLDRAYKLVAPKAQRRAEIPKIEVQNMPRKTVIPNFGQIAKRLNRDIYFMAKFFQRELAVPGTVEGDVFTLHGEKSPKVVEAVYERFIRYYVVCPVCNSIDTELRREGRIYVMRCLACGASTPVKPL",
        "proteome": "UP000001694",
        "gene": "eif2b",
        "go_terms": [
            {
                "identifier": "GO:0003743",
                "name": "translation initiation factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006413",
                "name": "translational initiation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a35fe2fba492e761f58ae05573f9f5844fd2fe0d",
        "counters": {
            "domain_architectures": 6714,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 2,
                "smart": 1,
                "ncbifam": 1,
                "hamap": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6714
        }
    }
}