GET /api/protein/UniProt/B1YCG8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B1YCG8",
"id": "IF2B_PYRNV",
"source_organism": {
"taxId": "444157",
"scientificName": "Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / NBRC 100436 / V24Sta)",
"fullName": "Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / NBRC 100436 / V24Sta)"
},
"name": "Translation initiation factor 2 subunit beta",
"description": [
"eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA"
],
"length": 134,
"sequence": "MDEEYIALLDRAYKLVAPKAQRRAEIPKIEVQNMPRKTVIPNFGQIAKRLNRDIYFMAKFFQRELAVPGTVEGDVFTLHGEKSPKVVEAVYERFIRYYVVCPVCNSIDTELRREGRIYVMRCLACGASTPVKPL",
"proteome": "UP000001694",
"gene": "eif2b",
"go_terms": [
{
"identifier": "GO:0003743",
"name": "translation initiation factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006413",
"name": "translational initiation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a35fe2fba492e761f58ae05573f9f5844fd2fe0d",
"counters": {
"domain_architectures": 6714,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 2,
"smart": 1,
"ncbifam": 1,
"hamap": 1,
"pfam": 1,
"panther": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 6714
}
}
}