"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B1YCG8"	"{'domain_architectures': 6714, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 2, 'smart': 1, 'ncbifam': 1, 'hamap': 1, 'pfam': 1, 'panther': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 6714}"	"['eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA']"	"eif2b"	"[{'identifier': 'GO:0003743', 'name': 'translation initiation factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006413', 'name': 'translational initiation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"IF2B_PYRNV"	"a35fe2fba492e761f58ae05573f9f5844fd2fe0d"	True	False	False	134	"Translation initiation factor 2 subunit beta"	3	"UP000001694"	"MDEEYIALLDRAYKLVAPKAQRRAEIPKIEVQNMPRKTVIPNFGQIAKRLNRDIYFMAKFFQRELAVPGTVEGDVFTLHGEKSPKVVEAVYERFIRYYVVCPVCNSIDTELRREGRIYVMRCLACGASTPVKPL"	"reviewed"	"{'taxId': '444157', 'scientificName': 'Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / NBRC 100436 / V24Sta)', 'fullName': 'Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / NBRC 100436 / V24Sta)'}"