GET /api/protein/UniProt/B1LV81/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B1LV81",
        "id": "B1LV81_METRJ",
        "source_organism": {
            "taxId": "426355",
            "scientificName": "Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)",
            "fullName": "Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)"
        },
        "name": "Nitrogen regulatory protein P-II",
        "description": [
            "In nitrogen-limiting conditions, when the ratio of Gln to 2-ketoglutarate decreases, P-II is uridylylated to P-II-UMP. P-II-UMP allows the deadenylation of glutamine synthetase (GS), thus activating the enzyme. Conversely, in nitrogen excess P-II is deuridylated and promotes the adenylation of GS. P-II indirectly controls the transcription of the GS gene (glnA). P-II prevents NR-II-catalyzed conversion of NR-I to NR-I-phosphate, the transcriptional activator of glnA. When P-II is uridylylated to P-II-UMP, these events are reversed"
        ],
        "length": 112,
        "sequence": "MKKIEAIIKPFKLDEVKEALQEVGLQGITVIEAKGFGRQKGHTELYRGAEYVVDFLPKVKLEIVLSDALVEGAVEAIRKSAQTGRIGDGKIFVSTIEEAIRIRTGETGTDAI",
        "proteome": null,
        "gene": "Mrad2831_5130",
        "go_terms": [
            {
                "identifier": "GO:0030234",
                "name": "enzyme regulator activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006808",
                "name": "regulation of nitrogen utilization",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d8220377dbaba070bd97071aa55ce9e6a39bd20d",
        "counters": {
            "domain_architectures": 32412,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "profile": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "smart": 1,
                "pirsf": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 2,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 32412
        }
    }
}