"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B1LV81"	"{'domain_architectures': 25903, 'entries': 15, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'ssf': 1, 'cathgene3d': 1, 'profile': 1, 'smart': 1, 'pirsf': 1, 'panther': 1, 'prosite': 2, 'prints': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 25903}"	"['In nitrogen-limiting conditions, when the ratio of Gln to 2-ketoglutarate decreases, P-II is uridylylated to P-II-UMP. P-II-UMP allows the deadenylation of glutamine synthetase (GS), thus activating the enzyme. Conversely, in nitrogen excess P-II is deuridylated and promotes the adenylation of GS. P-II indirectly controls the transcription of the GS gene (glnA). P-II prevents NR-II-catalyzed conversion of NR-I to NR-I-phosphate, the transcriptional activator of glnA. When P-II is uridylylated to P-II-UMP, these events are reversed']"	"Mrad2831_5130"	"[{'identifier': 'GO:0030234', 'name': 'enzyme regulator activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006808', 'name': 'regulation of nitrogen utilization', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"B1LV81_METRJ"	"d8220377dbaba070bd97071aa55ce9e6a39bd20d"	True	False	112	"Nitrogen regulatory protein P-II"	3	"UP000006589"	"MKKIEAIIKPFKLDEVKEALQEVGLQGITVIEAKGFGRQKGHTELYRGAEYVVDFLPKVKLEIVLSDALVEGAVEAIRKSAQTGRIGDGKIFVSTIEEAIRIRTGETGTDAI"	"unreviewed"	"{'taxId': '426355', 'scientificName': 'Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)', 'fullName': 'Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)'}"
