GET /api/protein/UniProt/B1JBQ7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B1JBQ7",
        "id": "RRF_PSEPW",
        "source_organism": {
            "taxId": "390235",
            "scientificName": "Pseudomonas putida (strain W619)",
            "fullName": "Pseudomonas putida (strain W619)"
        },
        "name": "Ribosome-recycling factor",
        "description": [
            "Responsible for the release of ribosomes from messenger RNA at the termination of protein biosynthesis. May increase the efficiency of translation by recycling ribosomes from one round of translation to another"
        ],
        "length": 185,
        "sequence": "MINDIKKDAQDRMGKSIEALGRNLASIRTGRAHPSILDSVKVPAWGSEMPLNQVAAVSVEDARTLKIVAHDKNLSAAIEKAILTSDLGLNPSSAGTTIRVPMPALTEETRKGYTKQASAVAEDAKVAVRNVRRDALADLKKLTKDKEISEDEERRAADEIQKLTDKFVAEIDAAFKAKEKDLLAV",
        "proteome": null,
        "gene": "frr",
        "go_terms": [
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2d958ca5738752922f7c19b7aa2806b876ecf5c1",
        "counters": {
            "domain_architectures": 30231,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cdd": 1,
                "cathgene3d": 2,
                "pfam": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 30231
        }
    }
}