"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B1JBQ7"	"{'domain_architectures': 30231, 'entries': 11, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cdd': 1, 'cathgene3d': 2, 'pfam': 1, 'hamap': 1, 'panther': 1, 'ncbifam': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 30231}"	"['Responsible for the release of ribosomes from messenger RNA at the termination of protein biosynthesis. May increase the efficiency of translation by recycling ribosomes from one round of translation to another']"	"frr"	"[{'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"RRF_PSEPW"	"2d958ca5738752922f7c19b7aa2806b876ecf5c1"	True	False	False	185	"Ribosome-recycling factor"	3	""	"MINDIKKDAQDRMGKSIEALGRNLASIRTGRAHPSILDSVKVPAWGSEMPLNQVAAVSVEDARTLKIVAHDKNLSAAIEKAILTSDLGLNPSSAGTTIRVPMPALTEETRKGYTKQASAVAEDAKVAVRNVRRDALADLKKLTKDKEISEDEERRAADEIQKLTDKFVAEIDAAFKAKEKDLLAV"	"reviewed"	"{'taxId': '390235', 'scientificName': 'Pseudomonas putida (strain W619)', 'fullName': 'Pseudomonas putida (strain W619)'}"