General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B0SDN6",
        "id": "EFTS_LEPBA",
        "source_organism": {
            "taxId": "355278",
            "scientificName": "Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)",
            "fullName": "Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)"
        },
        "name": "Elongation factor Ts",
        "description": [
            "Associates with the EF-Tu.GDP complex and induces the exchange of GDP to GTP. It remains bound to the aminoacyl-tRNA.EF-Tu.GTP complex up to the GTP hydrolysis stage on the ribosome"
        ],
        "length": 198,
        "sequence": "MAVSSEQIKDLRERTGAGMMDCKKALEEKGGDIEKAVTYLREKGLAKAAKRAGRETGEGKVIAYVHGTGKTGVLVELNCETDFVANNEAFEALGKEIALQITAMSPLYVSEESIPKSEIENEMSVQKALLEKEGKKADQIEKILPGKMKKYYEDICLIHQKSIRDNSKTINDLLQEAIAKFGENITVGRFSRFQVGGN",
        "proteome": null,
        "gene": "tsf",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003746",
                "name": "translation elongation factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006414",
                "name": "translational elongation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e306dcabf09a9d3c61646b5a7166f454af96122b",
        "counters": {
            "domain_architectures": 26045,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 2,
                "cdd": 1,
                "ncbifam": 1,
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "prosite": 2,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 26045
        }
    }
}