"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B0SDN6"	"{'domain_architectures': 26045, 'entries': 17, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 3, 'ssf': 2, 'cdd': 1, 'ncbifam': 1, 'hamap': 1, 'panther': 1, 'pfam': 1, 'prosite': 2, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 26045}"	"['Associates with the EF-Tu.GDP complex and induces the exchange of GDP to GTP. It remains bound to the aminoacyl-tRNA.EF-Tu.GTP complex up to the GTP hydrolysis stage on the ribosome']"	"tsf"	"[{'identifier': 'GO:0005515', 'name': 'protein binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003746', 'name': 'translation elongation factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006414', 'name': 'translational elongation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"EFTS_LEPBA"	"e306dcabf09a9d3c61646b5a7166f454af96122b"	True	False	False	198	"Elongation factor Ts"	3	""	"MAVSSEQIKDLRERTGAGMMDCKKALEEKGGDIEKAVTYLREKGLAKAAKRAGRETGEGKVIAYVHGTGKTGVLVELNCETDFVANNEAFEALGKEIALQITAMSPLYVSEESIPKSEIENEMSVQKALLEKEGKKADQIEKILPGKMKKYYEDICLIHQKSIRDNSKTINDLLQEAIAKFGENITVGRFSRFQVGGN"	"reviewed"	"{'taxId': '355278', 'scientificName': 'Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)', 'fullName': 'Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)'}"