General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A9JSE2",
        "id": "A9JSE2_XENTR",
        "source_organism": {
            "taxId": "8364",
            "scientificName": "Xenopus tropicalis",
            "fullName": "Xenopus tropicalis (Western clawed frog)"
        },
        "name": "Heme-binding protein 1",
        "description": [
            "May bind free porphyrinogens that may be present in the cell and thus facilitate removal of these potentially toxic compound. Binds with a high affinity to one molecule of heme or porphyrins. It binds metalloporphyrins, free porphyrins and N-methylprotoporphyrin with similar affinities"
        ],
        "length": 209,
        "sequence": "MKNLVALLLLSLLYLHGTTSLAEDINSDAETLPAFCTSYKCPRYQLIKKYEKFEHRIYNATNWVTTSLKLDFLGIGLAKSFKRLLDYINGKNSEGLVMKMTVPVRIKVPRSDILSTNATMSFFVPPAVDTLPTPLNPDIYVEQLPEISVYVRSFGGYALNSDYEKQAKILVEELEALELSYNSSYGTAAGYNDPLTFFNRHNEVWYMAL",
        "proteome": "UP000008143",
        "gene": "XB5894820",
        "go_terms": null,
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "12f118d6591514820bcda0aafdb2ea69276e8e2f",
        "counters": {
            "domain_architectures": 8819,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8819
        }
    }
}