"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A9JSE2"	"{'domain_architectures': 8819, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 8819}"	"['May bind free porphyrinogens that may be present in the cell and thus facilitate removal of these potentially toxic compound. Binds with a high affinity to one molecule of heme or porphyrins. It binds metalloporphyrins, free porphyrins and N-methylprotoporphyrin with similar affinities']"	"XB5894820"	""	"A9JSE2_XENTR"	"12f118d6591514820bcda0aafdb2ea69276e8e2f"	True	False	False	209	"Heme-binding protein 1"	2	"UP000008143"	"MKNLVALLLLSLLYLHGTTSLAEDINSDAETLPAFCTSYKCPRYQLIKKYEKFEHRIYNATNWVTTSLKLDFLGIGLAKSFKRLLDYINGKNSEGLVMKMTVPVRIKVPRSDILSTNATMSFFVPPAVDTLPTPLNPDIYVEQLPEISVYVRSFGGYALNSDYEKQAKILVEELEALELSYNSSYGTAAGYNDPLTFFNRHNEVWYMAL"	"unreviewed"	"{'taxId': '8364', 'scientificName': 'Xenopus tropicalis', 'fullName': 'Xenopus tropicalis (Western clawed frog)'}"