HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A9JLZ1",
"id": "A9JLZ1_ASFPP",
"source_organism": {
"taxId": "443878",
"scientificName": "African swine fever virus (isolate Pig/Portugal/OURT88/1988)",
"fullName": "African swine fever virus (isolate Pig/Portugal/OURT88/1988) (ASFV)"
},
"name": "DNA-directed RNA polymerase RPB10 homolog",
"description": [
"Component of the DNA-directed RNA polymerase (RNAP) that catalyzes the transcription in the cytoplasm of viral DNA into RNA using the four ribonucleoside triphosphates as substrates"
],
"length": 80,
"sequence": "MLIPVVCFTCGFPIGTYAAIFDKARTEYIKTKMDGTLPQNIPLDASLQIELKDLITALGIPMRVCCRTHLITTLDYRKYY",
"proteome": null,
"gene": "CP80R",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003899",
"name": "DNA-directed RNA polymerase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006351",
"name": "DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "7038d5dbbe25fce9346d9633f5fddfe23d8947e0",
"counters": {
"domain_architectures": 4864,
"entries": 7,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 4864
}
}
}