"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A9JLZ1"	"{'domain_architectures': 4864, 'entries': 7, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'prosite': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 4864}"	"['Component of the DNA-directed RNA polymerase (RNAP) that catalyzes the transcription in the cytoplasm of viral DNA into RNA using the four ribonucleoside triphosphates as substrates']"	"CP80R"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003899', 'name': 'DNA-directed RNA polymerase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006351', 'name': 'DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0008270', 'name': 'zinc ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A9JLZ1_ASFPP"	"7038d5dbbe25fce9346d9633f5fddfe23d8947e0"	False	False	False	80	"DNA-directed RNA polymerase RPB10 homolog"	3	""	"MLIPVVCFTCGFPIGTYAAIFDKARTEYIKTKMDGTLPQNIPLDASLQIELKDLITALGIPMRVCCRTHLITTLDYRKYY"	"unreviewed"	"{'taxId': '443878', 'scientificName': 'African swine fever virus (isolate Pig/Portugal/OURT88/1988)', 'fullName': 'African swine fever virus (isolate Pig/Portugal/OURT88/1988) (ASFV)'}"