HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A9H3E2",
"id": "RNH2_GLUDA",
"source_organism": {
"taxId": "272568",
"scientificName": "Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)",
"fullName": "Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)"
},
"name": "Ribonuclease HII",
"description": [
"Endonuclease that specifically degrades the RNA of RNA-DNA hybrids"
],
"length": 224,
"sequence": "MPDYTREMQHGGRVAGVDEVGRGPLAGPVVAAAVMFDSGVPRRLVTQLDDSKKLTEAARLRAYAALHAARGVHIAVAAASVSEIARLNILRAAFLAMRRAVARLPHQPDMVLVDGNAAPDFGCPAQCVVGGDGESLSIAAASIVAKVVRDRLMARLSCRWPGYGWERNAGYGTAEHRAALCRAGTTPHHREAFGLVRQLTLGLVPAAAPGMAPGLVPAVLEDVS",
"proteome": "UP000001176",
"gene": "rnhB",
"go_terms": [
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004523",
"name": "RNA-DNA hybrid ribonuclease activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "be57e75a8d1d76f6feea61410b1a5573546b0a8f",
"counters": {
"domain_architectures": 28247,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 28247
}
}
}