"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A9H3E2"	"{'domain_architectures': 20055, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'pfam': 1, 'cdd': 1, 'panther': 1, 'hamap': 1, 'ncbifam': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 20055}"	"['Endonuclease that specifically degrades the RNA of RNA-DNA hybrids']"	"rnhB"	"[{'identifier': 'GO:0003676', 'name': 'nucleic acid binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0004523', 'name': 'RNA-DNA hybrid ribonuclease activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"RNH2_GLUDA"	"be57e75a8d1d76f6feea61410b1a5573546b0a8f"	True	False	224	"Ribonuclease HII"	3	"UP000001176"	"MPDYTREMQHGGRVAGVDEVGRGPLAGPVVAAAVMFDSGVPRRLVTQLDDSKKLTEAARLRAYAALHAARGVHIAVAAASVSEIARLNILRAAFLAMRRAVARLPHQPDMVLVDGNAAPDFGCPAQCVVGGDGESLSIAAASIVAKVVRDRLMARLSCRWPGYGWERNAGYGTAEHRAALCRAGTTPHHREAFGLVRQLTLGLVPAAAPGMAPGLVPAVLEDVS"	"reviewed"	"{'taxId': '272568', 'scientificName': 'Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)', 'fullName': 'Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)'}"