General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A9CB94",
        "id": "CAP8_ADES1",
        "source_organism": {
            "taxId": "189830",
            "scientificName": "Snake adenovirus serotype 1",
            "fullName": "Snake adenovirus serotype 1 (SnAdV-1)"
        },
        "name": "Pre-hexon-linking protein VIII",
        "description": [
            "Structural component of the virion that acts as a cement protein on the capsid interior and which glues the peripentonal hexons and group-of-nine hexons together",
            "Structural component of the virion that acts as a cement protein on the capsid interior and which glue the peripentonal hexons and group-of-nine hexons together"
        ],
        "length": 278,
        "sequence": "MEAPVTPYIWQYQPETGTAAGARQNYGAVINWLSSDNNMYHRVQEVNRQRNKIDDFREQTVRADMAHSFNDWKPQQLSQPASTAYLPAPNPIAGPRTIPDVIFTAEGEQLAGASPSLLSGGASLPPSSYRLGDGREYRKFTRDAMPFPHNWLVKENGVWVPVEERDPLLSEEGRNALSSYPTLTYAQPPILRYRRLGQQLQGGGVVAPSSRVVSLLTEQPRMPRTEGMTPYQFSAEFPPVVYDHPFSRNLTLFPKEFSPLFDPKDQVLATSLATLQYR",
        "proteome": "UP000136605",
        "gene": "L4",
        "go_terms": [
            {
                "identifier": "GO:0031423",
                "name": "hexon binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019028",
                "name": "viral capsid",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "b0221ec7dd5352f0a73f8af95a99cd79973901ea",
        "counters": {
            "domain_architectures": 19,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "hamap": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 19
        }
    }
}