GET /api/protein/UniProt/A9CB94/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A9CB94",
"id": "CAP8_ADES1",
"source_organism": {
"taxId": "189830",
"scientificName": "Snake adenovirus serotype 1",
"fullName": "Snake adenovirus serotype 1 (SnAdV-1)"
},
"name": "Pre-hexon-linking protein VIII",
"description": [
"Structural component of the virion that acts as a cement protein on the capsid interior and which glues the peripentonal hexons and group-of-nine hexons together",
"Structural component of the virion that acts as a cement protein on the capsid interior and which glue the peripentonal hexons and group-of-nine hexons together"
],
"length": 278,
"sequence": "MEAPVTPYIWQYQPETGTAAGARQNYGAVINWLSSDNNMYHRVQEVNRQRNKIDDFREQTVRADMAHSFNDWKPQQLSQPASTAYLPAPNPIAGPRTIPDVIFTAEGEQLAGASPSLLSGGASLPPSSYRLGDGREYRKFTRDAMPFPHNWLVKENGVWVPVEERDPLLSEEGRNALSSYPTLTYAQPPILRYRRLGQQLQGGGVVAPSSRVVSLLTEQPRMPRTEGMTPYQFSAEFPPVVYDHPFSRNLTLFPKEFSPLFDPKDQVLATSLATLQYR",
"proteome": "UP000136605",
"gene": "L4",
"go_terms": [
{
"identifier": "GO:0031423",
"name": "hexon binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019028",
"name": "viral capsid",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "b0221ec7dd5352f0a73f8af95a99cd79973901ea",
"counters": {
"domain_architectures": 19,
"entries": 3,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"hamap": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 19
}
}
}