"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A9CB94"	"{'domain_architectures': 19, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'hamap': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 19}"	"['Structural component of the virion that acts as a cement protein on the capsid interior and which glues the peripentonal hexons and group-of-nine hexons together', 'Structural component of the virion that acts as a cement protein on the capsid interior and which glue the peripentonal hexons and group-of-nine hexons together']"	"L4"	"[{'identifier': 'GO:0031423', 'name': 'hexon binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0019028', 'name': 'viral capsid', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"CAP8_ADES1"	"b0221ec7dd5352f0a73f8af95a99cd79973901ea"	False	False	False	278	"Pre-hexon-linking protein VIII"	3	"UP000136605"	"MEAPVTPYIWQYQPETGTAAGARQNYGAVINWLSSDNNMYHRVQEVNRQRNKIDDFREQTVRADMAHSFNDWKPQQLSQPASTAYLPAPNPIAGPRTIPDVIFTAEGEQLAGASPSLLSGGASLPPSSYRLGDGREYRKFTRDAMPFPHNWLVKENGVWVPVEERDPLLSEEGRNALSSYPTLTYAQPPILRYRRLGQQLQGGGVVAPSSRVVSLLTEQPRMPRTEGMTPYQFSAEFPPVVYDHPFSRNLTLFPKEFSPLFDPKDQVLATSLATLQYR"	"reviewed"	"{'taxId': '189830', 'scientificName': 'Snake adenovirus serotype 1', 'fullName': 'Snake adenovirus serotype 1 (SnAdV-1)'}"