General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A9BN29",
        "id": "A9BN29_DELAS",
        "source_organism": {
            "taxId": "398578",
            "scientificName": "Delftia acidovorans (strain DSM 14801 / SPH-1)",
            "fullName": "Delftia acidovorans (strain DSM 14801 / SPH-1)"
        },
        "name": "peptidylprolyl isomerase",
        "description": [
            "Also involved in hydrogenase metallocenter assembly, probably by participating in the nickel insertion step. This function in hydrogenase biosynthesis requires chaperone activity and the presence of the metal-binding domain, but not PPIase activity"
        ],
        "length": 173,
        "sequence": "MEITEQCVVALTWTLKDTLGEELDVLDEPVEFLVGGDDLLKRIEEALQGHGQGKTLDLHLEPEEAFGDYNESLIFLEPRALFPAELEEGMSFEASALPKGCSAVQPDLLYTVTEIYPEHVVLDGNHPLAGIALRLHLKVEGVREATEEEIGRGSAGTGFFRIQPMAPGNDTLH",
        "proteome": "UP000000784",
        "gene": "Daci_5095",
        "go_terms": [
            {
                "identifier": "GO:0003755",
                "name": "peptidyl-prolyl cis-trans isomerase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1
        }
    }
}