"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A9BN29"	"{'domain_architectures': 0, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1}"	"['Also involved in hydrogenase metallocenter assembly, probably by participating in the nickel insertion step. This function in hydrogenase biosynthesis requires chaperone activity and the presence of the metal-binding domain, but not PPIase activity']"	"Daci_5095"	"[{'identifier': 'GO:0003755', 'name': 'peptidyl-prolyl cis-trans isomerase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A9BN29_DELAS"	""	True	False	False	173	"peptidylprolyl isomerase"	3	"UP000000784"	"MEITEQCVVALTWTLKDTLGEELDVLDEPVEFLVGGDDLLKRIEEALQGHGQGKTLDLHLEPEEAFGDYNESLIFLEPRALFPAELEEGMSFEASALPKGCSAVQPDLLYTVTEIYPEHVVLDGNHPLAGIALRLHLKVEGVREATEEEIGRGSAGTGFFRIQPMAPGNDTLH"	"unreviewed"	"{'taxId': '398578', 'scientificName': 'Delftia acidovorans (strain DSM 14801 / SPH-1)', 'fullName': 'Delftia acidovorans (strain DSM 14801 / SPH-1)'}"