GET /api/protein/UniProt/A8ZNS1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A8ZNS1",
        "id": "ATP62_ACAM1",
        "source_organism": {
            "taxId": "329726",
            "scientificName": "Acaryochloris marina (strain MBIC 11017)",
            "fullName": "Acaryochloris marina (strain MBIC 11017)"
        },
        "name": "ATP synthase subunit a 2",
        "description": [
            "Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane"
        ],
        "length": 234,
        "sequence": "MHLTPDQTIFWQWGLFSLNATLIFTWLVMGVLVVGSWFVTRHLSASTQISRGQNLLEVIVLGIRDQIQEIIDQPADPYLPFIGTLFIFIALSNLLSVIPGYQPPTGSLSTTTALALCVFFAVPLYGVQKKGVRGYLQQYLQPNPIMLPFNIIGDFSRIVALAVRLFGNVMSGTMIVGILLSVAPLFFPVMMQVLGLLTGVIQAYIFAILAMVFIAAASQVDQHNYQTDSEVSHG",
        "proteome": "UP000000268",
        "gene": "atpB2",
        "go_terms": [
            {
                "identifier": "GO:0015078",
                "name": "proton transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015986",
                "name": "proton motive force-driven ATP synthesis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0045259",
                "name": "proton-transporting ATP synthase complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "acaa664a20e87c3445188e8a4619f81f602dd2b5",
        "counters": {
            "domain_architectures": 79589,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "hamap": 1,
                "ncbifam": 3,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 79589
        }
    }
}